HIV Drug Resistance Profiling Pipeline using Bowtie2, Lofreq, and SierraPy
Help improve this workflow!
This workflow has been published but could be further improved with some additional meta data:- Keyword(s) in categories input, output, operation
You can help improve this workflow by suggesting the addition or removal of keywords, suggest changes and report issues, or request to become a maintainer of the Workflow .
Introduction
This is a pipeline for drug-resistance profiling from HIV whole genome NGS data. It takes in a HIV reference genome (currently HXB2) and a dataset of reads in (gzipped) fastq format, and performs the following steps:
-
aligns the reads to the reference,
-
performs variant calling, and
-
queries the HIVDB system for the presence and degree of drug resistance (requires internet connection).
Currently, the pipeline uses Bowtie2 for Step1, Lofreq for Step 2, and sierrapy for Step 3.
This code is under development. We hope to test and add more options.
Installation
This pipeline requires the package manager Conda and the workflow management system Snakemake . All other dependencies are handled automatically by Snakemake.
Install Conda
Download Miniconda3 installer for Linux from here , or for macOS from here Installation instructions are here . Once installation is complete, you can test your Miniconda installation by running:
$ conda list
Install Snakemake
Snakemake recommends installation via Conda:
$ conda install -c conda-forge mamba
$ mamba create -c conda-forge -c bioconda -n snakemake snakemake
This creates an isolated enviroment containing the latest Snakemake. To activate it:
$ conda activate snakemake
To test snakemake installation
$ snakemake --help
Download the pipeline
Clone this pipeline by clicking the Clone button on the top-right of this page, or download it by clicking the ellipsis next to the Clone button.
Quickstart Guide
Let's try running the pipeline on sample data provided in the
test_data
folder. With the snakemake conda environment activated, and from the top-level directory (i.e. the one that contains this readme file), run:
snakemake --use-conda --configfile config/config.sample.yaml -np
to do a dry-run. If snakemake does not complain and everything seems ok, then run:
snakemake --use-conda --configfile config/config.sample.yaml --cores all
The results can be found inside the newly created directory called
test_result
. Interpretation of drug-resistance as provided by sierrapy can be found inside the
drug_resistance_report
folder. Intermediate files such as the read-to-reference alignments and variant calls can be found in their respective folders.
Running the pipeline on your own data
To the run the pipeline on your own data, you need to specify in a config file (in YAML format) the paths to the input data (reads and reference), path to the output directory. Optionally, in this config file, you can also set parameters for the various tools that make up this pipeline. You can use
config/config.template.yaml
as a template. Once the configfile is ready, run the pipeline like above:
snakemake --use-conda --configfile /path/to/configfile -np
for a dry run, and
snakemake --use-conda --configfile /path/to/configfile --cores all
for the actual run.
Contact
This is an ongoing work. If you have questions, concerns, issues, or suggestions, please contact: Anish Shrestha, Bioinformatics Lab, De La Salle University Manila at [email protected] .
Code Snippets
13 14 15 16 17 | shell: """ samtools faidx {input.reference} samtools view -bt {params.last_index_basename} {input.sam} > {output} """ |
26 27 | shell: "samtools sort -o {output} {input}" |
36 37 | shell: "samtools index {input}" |
29 30 | shell: "bowtie2-build {input.reference} {params.index_basename}" |
47 48 | shell: "bowtie2 --local --{params.preset} -x {params.index_basename} -1 {input.sub1} -2 {input.sub2} | samtools view -bS - > {output}" |
12 13 14 15 16 | shell: """ seqtk trimfq {input.reads1} > {output.trim1} seqtk trimfq {input.reads2} > {output.trim2} """ |
32 33 34 35 36 | shell: """ seqtk sample -s {params.seed} {input.trim1} {params.n} > {output.sub1} seqtk sample -s {params.seed} {input.trim2} {params.n} > {output.sub2} """ |
8 9 | shell: "python workflow/scripts/vcfToHivdb.py --vcfFile {input} --outFile {output}" |
18 19 | shell: "python workflow/scripts/tabulateJson.py --jsonFile {input} --outFile {output}" |
75 76 | shell: "lastdb {params.index_basename} {input.reference}" |
90 91 92 93 94 95 | shell: """ set +o pipefail; gzip -cdf {input.query} | head -n 400000 > {params.last_sample1} last-train --verbose --revsym --matsym --gapsym --sample-number=400000 -Q1 {params.last_index_basename} {params.last_sample1} > {output} """ |
126 127 | shell: "picard CreateSequenceDictionary R={input.reference} O={output}" |
146 147 148 149 150 151 152 | shell: """ fastq-interleave {input.reads1} {input.reads2} | lastal -Q1 -i1 -p {input.scoring} {params.last_index_basename} | last-pair-probs -f {params.mean} -s {params.std} -m 0.01 -d 0.1 | maf-convert sam -f {input.dict} > {output} """ |
12 13 14 15 16 | shell: """ lofreq faidx {input.reference} lofreq call-parallel --pp-threads {threads} -f {input.reference} -o {output} {input.bam} """ |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 | from tabulate import tabulate import json if __name__ == '__main__': import argparse parser = argparse.ArgumentParser(description='') parser.add_argument('--jsonFile', required=True) parser.add_argument('--outFile', required=True) args = parser.parse_args() data = json.load(open(args.jsonFile)) vResults = data['validationResults'] drugResistance = data['drugResistance'] dbResults = "" # Printing the validation results # print("Validation Results") for v in vResults: dbResults += "\n" + v['level'] + ": " + v['message'] + "\n" # Printing drug resistance results for d in drugResistance: dbResults += "\n\nDrug resistance interpretation: " + d['gene']['name'] dbResults += "\nVersion: " + d['version']['text'] + "(" + d['version']['publishDate'] + ")" drugClass = [] drug = [] score = [] partialScores = [] text = [] ctr = 0 # Store the relevant information into a new dictionary for d2 in d['drugScores']: drugClass.append(d2['drugClass']['name']) drug.append(d2['drug']['displayAbbr']) score.append(d2['score']) partialScores.append(d2['partialScores']) text.append(d2['text']) ctr+=1 results = { 'drugClass' : drugClass, 'drug' : drug, 'score' : score, 'text' : text } # Display Drug Resistance Results Table #display(pd.DataFrame(results)) dbResults += "\n" dbResults += tabulate(results, headers = 'keys', tablefmt = 'psql') dbResults += "\n" # Printing partial scores, mutations, and comments for p in partialScores: if(p): mutations = p[0]['mutations'] for m in mutations: dbResults += "\n" dbResults += "Mutation: " + m['text'] + "\n" dbResults += "Type: " + m['primaryType'] + "\n" dbResults += "Comments:\n" comments = m['comments'] for c in comments: dbResults += c['text'] + "\n" #print(dbResults) f = open(args.outFile, 'w') f.write(dbResults) f.close() #print (output) |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 | import vcf #from pysam import VariantFile import subprocess #coordinates of the 3 genes in 1-based coordinates (because VCF is 1-based) #protease pStart = 2253 pEnd = 2549 #reverse-transcriptase rtStart = 2550 rtEnd = 4229 #integrase iStart = 4230 iEnd = 5093 #HIVDB protein sequences: protease_hivdb="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF" rt_hivdb = "PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKI"\ "GPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL"\ "KKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLP"\ "QGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRT"\ "KIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKD"\ "SWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE"\ "LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLK"\ "TGKYARMRGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA"\ "WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRET"\ "KLGKAGYVTDRGRQKVVSLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQ"\ "YALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK"\ "LVSAGIRKVL" integrase_hivdb = "FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAM"\ "HGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYF"\ "LLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGV"\ "VESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERI"\ "VDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVV"\ "IQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED" # #HXB2 translated protein sequences (translated based on gene coordinates above) #protease_hxb2="PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF" #rt_hxb2= "PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKI"\ # "GPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL"\ # "KKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLP"\ # "QGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRT"\ # "KIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKD"\ # "SWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE"\ # "LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLK"\ # "TGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET"\ # "WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRET"\ # "KLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQ"\ # "YALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK"\ # "LVSAGIRKVL" #integrase_hxb2 = "FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAM"\ # "HGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYF"\ # "LLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGV"\ # "VESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERI"\ # "VDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVV"\ # "IQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED" protease_hxb2 = "CCTCAGGTCACTCTTTGGCAACGACCCCTCGTCACAATAAAGATAGGGGGGCAACTAAAGGAAGCTCTATTAGATACAGGAGCAGATGATACAGTATTAGAAGAAATGAGTTTGCCAGGAAGATGGAAACCAAAAATGATAGGGGGAATTGGAGGTTTTATCAAAGTAAGACAGTATGATCAGATACTCATAGAAATCTGTGGACATAAAGCTATAGGTACAGTATTAGTAGGACCTACACCTGTCAACATAATTGGAAGAAATCTGTTGACTCAGATTGGTTGCACTTTAAATTTT" rt_hxb2 = "CCCATTAGCCCTATTGAGACTGTACCAGTAAAATTAAAGCCAGGAATGGATGGCCCAAAAGTTAAACAATGGCCATTGACAGAAGAAAAAATAAAAGCATTAGTAGAAATTTGTACAGAGATGGAAAAGGAAGGGAAAATTTCAAAAATTGGGCCTGAAAATCCATACAATACTCCAGTATTTGCCATAAAGAAAAAAGACAGTACTAAATGGAGAAAATTAGTAGATTTCAGAGAACTTAATAAGAGAACTCAAGACTTCTGGGAAGTTCAATTAGGAATACCACATCCCGCAGGGTTAAAAAAGAAAAAATCAGTAACAGTACTGGATGTGGGTGATGCATATTTTTCAGTTCCCTTAGATGAAGACTTCAGGAAGTATACTGCATTTACCATACCTAGTATAAACAATGAGACACCAGGGATTAGATATCAGTACAATGTGCTTCCACAGGGATGGAAAGGATCACCAGCAATATTCCAAAGTAGCATGACAAAAATCTTAGAGCCTTTTAGAAAACAAAATCCAGACATAGTTATCTATCAATACATGGATGATTTGTATGTAGGATCTGACTTAGAAATAGGGCAGCATAGAACAAAAATAGAGGAGCTGAGACAACATCTGTTGAGGTGGGGACTTACCACACCAGACAAAAAACATCAGAAAGAACCTCCATTCCTTTGGATGGGTTATGAACTCCATCCTGATAAATGGACAGTACAGCCTATAGTGCTGCCAGAAAAAGACAGCTGGACTGTCAATGACATACAGAAGTTAGTGGGGAAATTGAATTGGGCAAGTCAGATTTACCCAGGGATTAAAGTAAGGCAATTATGTAAACTCCTTAGAGGAACCAAAGCACTAACAGAAGTAATACCACTAACAGAAGAAGCAGAGCTAGAACTGGCAGAAAACAGAGAGATTCTAAAAGAACCAGTACATGGAGTGTATTATGACCCATCAAAAGACTTAATAGCAGAAATACAGAAGCAGGGGCAAGGCCAATGGACATATCAAATTTATCAAGAGCCATTTAAAAATCTGAAAACAGGAAAATATGCAAGAATGAGGGGTGCCCACACTAATGATGTAAAACAATTAACAGAGGCAGTGCAAAAAATAACCACAGAAAGCATAGTAATATGGGGAAAGACTCCTAAATTTAAACTGCCCATACAAAAGGAAACATGGGAAACATGGTGGACAGAGTATTGGCAAGCCACCTGGATTCCTGAGTGGGAGTTTGTTAATACCCCTCCCTTAGTGAAATTATGGTACCAGTTAGAGAAAGAACCCATAGTAGGAGCAGAAACCTTCTATGTAGATGGGGCAGCTAACAGGGAGACTAAATTAGGAAAAGCAGGATATGTTACTAATAGAGGAAGACAAAAAGTTGTCACCCTAACTGACACAACAAATCAGAAGACTGAGTTACAAGCAATTTATCTAGCTTTGCAGGATTCGGGATTAGAAGTAAACATAGTAACAGACTCACAATATGCATTAGGAATCATTCAAGCACAACCAGATCAAAGTGAATCAGAGTTAGTCAATCAAATAATAGAGCAGTTAATAAAAAAGGAAAAGGTCTATCTGGCATGGGTACCAGCACACAAAGGAATTGGAGGAAATGAACAAGTAGATAAATTAGTCAGTGCTGGAATCAGGAAAGTACTA" integrase_hxb2 = "TTTTTAGATGGAATAGATAAGGCCCAAGATGAACATGAGAAATATCACAGTAATTGGAGAGCAATGGCTAGTGATTTTAACCTGCCACCTGTAGTAGCAAAAGAAATAGTAGCCAGCTGTGATAAATGTCAGCTAAAAGGAGAAGCCATGCATGGACAAGTAGACTGTAGTCCAGGAATATGGCAACTAGATTGTACACATTTAGAAGGAAAAGTTATCCTGGTAGCAGTTCATGTAGCCAGTGGATATATAGAAGCAGAAGTTATTCCAGCAGAAACAGGGCAGGAAACAGCATATTTTCTTTTAAAATTAGCAGGAAGATGGCCAGTAAAAACAATACATACTGACAATGGCAGCAATTTCACCGGTGCTACGGTTAGGGCCGCCTGTTGGTGGGCGGGAATCAAGCAGGAATTTGGAATTCCCTACAATCCCCAAAGTCAAGGAGTAGTAGAATCTATGAATAAAGAATTAAAGAAAATTATAGGACAGGTAAGAGATCAGGCTGAACATCTTAAGACAGCAGTACAAATGGCAGTATTCATCCACAATTTTAAAAGAAAAGGGGGGATTGGGGGGTACAGTGCAGGGGAAAGAATAGTAGACATAATAGCAACAGACATACAAACTAAAGAATTACAAAAACAAATTACAAAAATTCAAAATTTTCGGGTTTATTACAGGGACAGCAGAAATCCACTTTGGAAAGGACCAGCAAAGCTCCTCTGGAAAGGTGAAGGGGCAGTAGTAATACAAGATAATAGTGACATAAAAGTAGTGCCAAGAAGAAAAGCAAAGATCATTAGGGATTATGGAAAACAGATGGCAGGTGATGATTGTGTGGCAAGTAGACAGGATGAGGAT" geneticCode ={ #Phenylalanine "TTT": "F", "TTC": "F", #Leucine "TTA": "L", "TTG": "L", "CTT": "L", "CTC": "L", "CTA": "L", "CTG": "L", #Isoleucine "ATT": "I", "ATC": "I","ATA": "I", #Methioinine "ATG": "M", #Valine "GTT": "V", "GTC": "V", "GTA": "V", "GTG": "V", #Serine "TCT": "S", "TCC": "S", "TCA": "S","TCG": "S","AGT": "S", "AGC": "S", #Proline "CCT": "P", "CCC": "P", "CCA": "P","CCG": "P", #Threonine "ACT": "T","ACC": "T","ACA": "T","ACG": "T", #Alanine "GCT": "A","GCC": "A","GCA": "A","GCG": "A", #Tyrosine "TAT": "Y","TAC": "Y", #Histidine "CAT": "H","CAC": "H", #Glutamine "CAA": "Q","CAG": "Q", #Asparagine "AAT": "N","AAC": "N", #Lysine "AAA": "K","AAG": "K", #Aspartic acid "GAT": "D","GAC": "D", #Glutamic acid "GAA": "E","GAG": "E", #Cysteine "TGT": "C","TGC": "C", #Tryptophan "TGG": "W", #Arginine "CGT": "R","CGC": "R","CGA": "R","CGG": "R","AGA": "R","AGG": "R", #Glycine "GGT": "G","GGC": "G","GGA": "G","GGG": "G", #stop "TAA": "*","TAG": "*","TGA": "*" } def getCombinations(base1, base2, base3,reference): # returns all possible combinations mutations = [] #print("Bases", base1, base2, base3) for i in range (len(base1)): for j in range (len(base2)): for k in range (len(base3)): codonStr = str(base1[i])+str(base2[j])+str(base3[k]) #print("CODON:",codonStr) trans = geneticCode.get(codonStr,"!") #print("TRANS:",trans, reference) if trans!="!" and trans!=reference: #add as a mutation only if it differs from the reference if trans not in mutations: #print("ALT codon",codonStr) mutations.append(trans) return mutations def getMutations_mult(mut,refG): #returns all possible amino acid mutations per position #protease mutList = [] ref_gene = list(refG) codonct = 1 #print("LENPROT",len(prot)) for i in range(0,len(mut),3): #print("I",i,prot[i]) #print("CODONCT ",codonct-1,ref_protease[codonct-1]) #print("Base:",prot[i],prot[i+1],prot[i+2]) combinations = getCombinations(mut[i],mut[i+1], mut[i+2],ref_gene[codonct-1]) if len(combinations)>0: # print("MUTATION:", codonct, ref_gene[codonct-1], "comb", combinations) mutList.append([codonct,ref_gene[codonct-1],combinations]) codonct = codonct + 1 #print("M",mutList) return mutList def createHIVDBRequest(prot,rt,integrase, out): cmd = "sierrapy mutations " #cmd = "" #protease # print("PROT1 ",len(prot)) for i in prot: # print("PROT: ", i) for j in i[2]: #print("SIERRA: " , i[0],i[1], j) mut = "PR:"+i[1]+str(i[0])+j #print("SIERRA", mut) cmd = cmd + " "+mut #RT for i in rt: #print("PROT: ", i) for j in i[2]: #print("SIERRA: " , i[0],i[1], j) mut = "RT:"+i[1]+str(i[0])+j #print("SIERRA", mut) cmd = cmd + " "+mut #RT for i in integrase: #print("PROT: ", i) for j in i[2]: #print("SIERRA: " , i[0],i[1], j) mut = "RT:"+i[1]+str(i[0])+j #print("SIERRA", mut) cmd = cmd + " "+mut #protStr #cmd = cmd + " -o "+out #cmd = 'sierrapy mutations PR:L10I -o output_171.json' # print(cmd) #print (subprocess.check_output(cmd, shell=True)) #output = subprocess.Popen(cmd, shell=True) output = subprocess.check_output(cmd, shell=True) file = open(out, 'w') file.write(output.decode("utf-8")) file.close() if __name__ == '__main__': import argparse parser = argparse.ArgumentParser(description='') parser.add_argument('--vcfFile', required=True) parser.add_argument('--outFile', required=True) args = parser.parse_args() vcf_reader = vcf.Reader(open(args.vcfFile,'r')) # vcf_reader = VariantFile(snakemake.input[0]) protease_seq = list(protease_hxb2) rt_seq = list(rt_hxb2) i_seq = list(integrase_hxb2) for record in vcf_reader: #print(record) if record.POS >=2253 and record.POS <2550: #protease alt = record.ALT temp = [] for i in range(len(alt[0])): base = str(alt[0])[i] if base not in temp: temp.append(base) protease_seq[record.POS-2253] = temp elif record.POS >=2550 and record.POS < 4229: #3869: #reverse transcriptase alt = record.ALT temp = [] for i in range(len(alt[0])): base = str(alt[0])[i] if base not in temp: temp.append(base) rt_seq[record.POS-2550] = temp elif record.POS >=4230 and record.POS <=5093: #5096 minus stop codon #integrase alt = record.ALT temp = [] for i in range(len(alt[0])): base = str(alt[0])[i] if base not in temp: temp.append(base) i_seq[record.POS-4230] = temp protease_mut = getMutations_mult(protease_seq,protease_hivdb) rt_mut = getMutations_mult(rt_seq,rt_hivdb) int_mut = getMutations_mult(i_seq,integrase_hivdb) #createHIVDBRequest(protease_mut, rt_mut,int_mut,snakemake.output[0]) createHIVDBRequest(protease_mut, rt_mut,int_mut,args.outFile) |
Support
- Future updates
Related Workflows
![psychip_snakemake](https://media.bioworkflows.com/bioworkflows/public_preview/791b56ccab3630bcb1746d66097f813640394655ed21d3c39cb591b7016d2994.jpg)
![ncov_2](https://media.bioworkflows.com/bioworkflows/public_preview/16bd34a67b114b98942f09d5bcfb47c01d0e12aaccac38e15c9bbcc5856d6139.jpg)
![cellranger-snakemake-gke](https://media.bioworkflows.com/bioworkflows/public_preview/1045115046015ac39a849801172555df3b41ec5023f7f7c8230f0640b8f89a2b.jpg)
![atlas](https://media.bioworkflows.com/bioworkflows/public_preview/2e9488df62bdb57adbd8f8a137263f57f970f5571566588f6242d63f73c67151.jpg)
![rna-seq-star-deseq2](https://media.bioworkflows.com/bioworkflows/public_preview/2b57d357da619c31943bbffc57e2cc955325669933c9b5b91e33b81fd78c18d4.jpg)
![dna-seq-gatk-variant-calling](https://media.bioworkflows.com/bioworkflows/public_preview/4b8eed0f6a179f18a43e601e653aee298718468aaf37ee1b3d0f8dddaffcaf6a.jpg)